Gene
SF2470

ptsH

Protein Sequence
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE
DNA Sequence
ATGTTCCAGCAAGAAGTTACCATTACCGCTCCGAACGGTCTGCACACCCGCCCTGCTGCCCAGTTTGTAAAAGAAGCTAAGGGCTTCACTTCTGAAATTACTGTGACTTCCAACGGCAAAAGCGCCAGCGCGAAAAGCCTGTTTAAACTGCAGACTCTGGGCCTGACTCAAGGTACCGTTGTGACTATCTCCGCAGAAGGCGAAGACGAGCAGAAAGCGGTTGAACATCTGGTTAAACTGATGGCGGAACTCGAGTAA
Associated reactions
  BiGG ID Name Gene reaction rule
ACGAptspp N-Acetyl-D-glucosamine transport via PEP:Pyr PTS (periplasm) (SF2472 and SF1105 and SF2470 and SF2471) or (SF0614 and SF2470 and SF2471)
ACMANAptspp N-acetyl-D-mannosamine transport via PTS (periplasm) SF1411 and SF1410 and SF1409 and SF2470 and SF2471
__iSF_1195__ACMUMptspp N-acetylmuramate transport via PEP:Pyr PTS (periplasm) SF2472 and SF2483 and SF2470 and SF2471
ARBTptspp arbutin transport via PEP:Pyr PTS (periplasm) SF3733 and SF2470 and SF2471
__iSF_1195__ASCBptspp L-ascorbate transport via PEP:Pyr PTS (periplasm) SF2470 and SF2471 and SF4350 and SF4349 and SF4348
__iSF_1195__CHITOBpts Chitobiose transport via PTS SF1490 and SF1488 and SF1489 and SF2470 and SF2471
DHAPT Dihydroxyacetone phosphotransferase SF1203 and SF1202 and SF1201 and SF2470 and SF2471
FRUpts2pp Fructose transport via PEP:Pyr PTS (f6p generating) (periplasm) SF1411 and SF1410 and SF1409 and SF2470 and SF2471
FRUptspp D-fructose transport via PEP:Pyr PTS (periplasm) SF2252 and SF2254 and SF2470 and SF2471
GALTptspp Galactitol transport via PEP:Pyr PTS (periplasm) SF2156 and SF2155 and SF2154 and SF2470 and SF2471
GAMptspp D-glucosamine transport via PEP:Pyr PTS (periplasm) SF1411 and SF1410 and SF1409 and SF2470 and SF2471
GLCptspp D-glucose transport via PEP:Pyr PTS (periplasm) (SF2472 and SF1645 and SF2470 and SF2471) or (SF2472 and SF1105 and SF2470 and SF2471) or (SF1411 and SF1410 and SF1409 and SF2470 and SF2471)
MALTptspp maltose transport via PEP:Pyr PTS (periplasm) SF2472 and SF1645 and SF2470 and SF2471
MANGLYCptspp 2-O-alpha-mannosyl-D-glycerate transport via PEP:Pyr PTS (periplasm) SF0566 and SF2470 and SF2471
MANptspp D-mannose transport via PEP:Pyr PTS (periplasm) SF1411 and SF1410 and SF1409 and SF2470 and SF2471
MNLptspp mannitol transport via PEP:Pyr PTS (periplasm) SF3633 and SF2470 and SF2471
SUCptspp sucrose transport via PEP:Pyr (periplasm) SF2472 and SF2483 and SF2470 and SF2471
TREptspp trehalose transport via PEP:Pyr PTS (periplasm) SF2472 and SF2470 and SF2471 and SF4250